PDB entry 3lrs

View 3lrs on RCSB PDB site
Description: Structure of PG16, an antibody with broad and potent neutralization of HIV-1
Class: immune system
Keywords: neutralizing antibodies, long CDRH3, HIV-1, IMMUNE SYSTEM
Deposited on 2010-02-11, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PG-16 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-End)
  • Chain 'B':
    Compound: PG-16 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-210)
    Domains in SCOPe 2.07: d3lrsb1, d3lrsb2
  • Chain 'C':
    Compound: PG-16 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-237)
  • Chain 'D':
    Compound: PG-16 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-210)
    Domains in SCOPe 2.07: d3lrsd1, d3lrsd2
  • Chain 'E':
    Compound: PG-16 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-End)
  • Chain 'F':
    Compound: PG-16 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-210)
    Domains in SCOPe 2.07: d3lrsf1, d3lrsf2
  • Chain 'H':
    Compound: PG-16 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-End)
  • Chain 'L':
    Compound: PG-16 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LRS (0-210)
    Domains in SCOPe 2.07: d3lrsl1, d3lrsl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lrsB (B:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lrsD (D:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lrsF (F:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lrsL (L:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt