PDB entry 3lrq

View 3lrq on RCSB PDB site
Description: Crystal structure of the U-box domain of human ubiquitin-protein ligase (E3), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4604D.
Class: ligase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Coiled coil, Ligase, Metal-binding, Peroxisome, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2010-02-11, released 2010-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase TRIM37
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0898, MUL, POB1, TRIM37
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94972 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.06: d3lrqa1, d3lrqa2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase TRIM37
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0898, MUL, POB1, TRIM37
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94972 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.06: d3lrqb1, d3lrqb2
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase TRIM37
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0898, MUL, POB1, TRIM37
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lrqc_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase TRIM37
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0898, MUL, POB1, TRIM37
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lrqd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lrqA (A:)
    mghhhhhhshmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraq
    cphcraplqlrelvncrwaeevtqqldtlqlcsltkheen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrqA (A:)
    hmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplq
    lrelvncrwaeevtqqldtlql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lrqB (B:)
    mghhhhhhshmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraq
    cphcraplqlrelvncrwaeevtqqldtlqlcsltkheen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrqB (B:)
    hmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplq
    lrelvncrwaeevtqqldtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lrqC (C:)
    mghhhhhhshmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraq
    cphcraplqlrelvncrwaeevtqqldtlqlcsltkheen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrqC (C:)
    mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
    relvncrwaeevtqqldtlqlc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lrqD (D:)
    mghhhhhhshmdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraq
    cphcraplqlrelvncrwaeevtqqldtlqlcsltkheen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrqD (D:)
    mdeqsvesiaevfrcficmeklrdarlcphcsklccfscirrwlteqraqcphcraplql
    relvncrwaeevtqqldtlqlcsl