PDB entry 3lrj

View 3lrj on RCSB PDB site
Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate synthase in complex with sulfate ion.
Class: lyase
Keywords: ENZYME-SULFATE COMPLEX, ALPHA+BETA BARREL, DRUG TARGET, antibacterial, Lyase, Metal-binding, Riboflavin biosynthesis
Deposited on 2010-02-11, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lrja_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lrjb_
  • Chain 'C':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lrjc_
  • Chain 'D':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lrjd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lrjA (A:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrjA (A:)
    fgtpfervelaldalregrgvmvldnegdmifpaetmtveqmaltirhgsgivclcited
    rrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnr
    pghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafag
    qhnmavvtiedlvayrqah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lrjB (B:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrjB (B:)
    tpfervelaldalregrgvmvlddnegdmifpaetmtveqmaltirhgsgivclcitedr
    rkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnrp
    ghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafagq
    hnmavvtiedlvayrqah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lrjC (C:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrjC (C:)
    fgtpfervelaldalregrgvmvldegdmifpaetmtveqmaltirhgsgivclcitedr
    rkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnrp
    ghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafagq
    hnmavvtiedlvayrqah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lrjD (D:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lrjD (D:)
    tpfervelaldalregrgvmvlddenegdmifpaetmtveqmaltirhgsgivclcited
    rrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnr
    pghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafag
    qhnmavvtiedlvayrqah