PDB entry 3lri

View 3lri on RCSB PDB site
Description: Solution structure and backbone dynamics of long-[Arg(3)]insulin-like growth factor-I
Class: growth factor
Keywords: insulin-like growth factor-1, growth factor, protein structure, distance geometry
Deposited on 1999-04-13, released 2000-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (insulin-like growth factor I)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05019 (13-82)
    • engineered (15)
    • engineered (51)
  Domains in SCOPe 2.07: d3lria_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lriA (A:)
  mfpamplsslfvngprtlcgaelvdalqfvcgdrgfyfnkptgygsssrracqtgivdec
  cfrscdlrrlemycaplkpaksa