PDB entry 3lri

View 3lri on RCSB PDB site
Description: solution structure and backbone dynamics of human long-[arg3]insulin-like growth factor 1
Class: growth factor
Keywords: insulin-like growth factor-1, growth factor, nmr, protein structure, distance geometry
Deposited on 1999-04-13, released 2000-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (insulin-like growth factor I)
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05019 (13-82)
    • engineered (15)
    • engineered (51)
  Domains in SCOP 1.75: d3lria_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lriA (A:)
  mfpamplsslfvngprtlcgaelvdalqfvcgdrgfyfnkptgygsssrracqtgivdec
  cfrscdlrrlemycaplkpaksa