PDB entry 3lri

View 3lri on RCSB PDB site
Description: solution structure and backbone dynamics of long-[arg(3)]insulin-like growth factor-i
Deposited on 1999-04-13, released 2000-05-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3lria_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lriA (A:)
    mfpamplsslfvngprtlcgaelvdalqfvcgdrgfyfnkptgygsssrracqtgivdec
    cfrscdlrrlemycaplkpaksa