PDB entry 3lqw

View 3lqw on RCSB PDB site
Description: Crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from Entamoeba histolytica
Class: hydrolase
Keywords: EMERALD BIOSTRUCTURES, ALS COLLABORATIVE CRYSTALLOGRAPHY, DEOXYURIDINA 5-TRIPHOSPHATE NUCLEOTIDOHYDROLASE, Hydrolase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2010-02-10, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.133
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Entamoeba histolytica [TaxId:294381]
    Gene: EHI_189420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lqwa_
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lqwA (A:)
    mahhhhhhmgtleaqtqgpgsmdevllvkklvedaivptrgskcaagidlysntnfiiqp
    herflvstgvsvqiphqcygriaprsslalkygidvgagvidedyrgeikvilfnhsnei
    fngrkgdriaqliierisycrisevkelnttdrgtngfgstgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lqwA (A:)
    devllvkklvedaivptrgskcaagidlysntnfiiqpherflvstgvsvqiphqcygri
    aprsslalkygidvgagvidedyrgeikvilfnhsneifngrkgdriaqliierisycri
    sevkelntt