PDB entry 3lqv
View 3lqv on RCSB PDB site
Description: Branch Recognition by SF3b14
Class: protein binding
Keywords: Cysless mutant, pre-mRNA splicing, adenine, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, protein binding
Deposited on
2010-02-10, released
2011-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-01-26, with a file datestamp of
2011-01-21.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.216
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pre-mRNA branch site protein p14
Species: Homo sapiens [TaxId:9606]
Gene: CGI-110, HSPC175, HT006, SF3B14
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Y3B4 (Start-114)
- conflict (63)
- conflict (72)
Domains in SCOPe 2.06: d3lqva_ - Chain 'B':
Compound: Pre-mRNA branch site protein p14
Species: Homo sapiens [TaxId:9606]
Gene: CGI-110, HSPC175, HT006, SF3B14
Database cross-references and differences (RAF-indexed):
- Uniprot Q9Y3B4 (0-114)
- conflict (63)
- conflict (72)
Domains in SCOPe 2.06: d3lqvb_ - Chain 'P':
Compound: Splicing factor 3B subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: SAP155, SF3B1, SF3b155
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: Splicing factor 3B subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: SAP155, SF3B1, SF3b155
Database cross-references and differences (RAF-indexed):
- Heterogens: ADE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3lqvA (A:)
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
Sequence, based on observed residues (ATOM records): (download)
>3lqvA (A:)
lppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdakn
avdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3lqvB (B:)
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.