PDB entry 3lqv

View 3lqv on RCSB PDB site
Description: Branch Recognition by SF3b14
Class: protein binding
Keywords: Cysless mutant, pre-mRNA splicing, adenine, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, protein binding
Deposited on 2010-02-10, released 2011-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA branch site protein p14
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-110, HSPC175, HT006, SF3B14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3B4 (Start-114)
      • conflict (63)
      • conflict (72)
    Domains in SCOPe 2.01: d3lqva_
  • Chain 'B':
    Compound: Pre-mRNA branch site protein p14
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-110, HSPC175, HT006, SF3B14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3B4 (0-114)
      • conflict (63)
      • conflict (72)
    Domains in SCOPe 2.01: d3lqvb_
  • Chain 'P':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAP155, SF3B1, SF3b155
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAP155, SF3B1, SF3b155
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3lqvA (A:)
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

    Sequence, based on observed residues (ATOM records): (download) 
    >3lqvA (A:)
lppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdakn
avdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lqvB (B:)
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.