PDB entry 3lqu

View 3lqu on RCSB PDB site
Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate synthase complexed with Ribulose-5 phosphate
Class: lyase
Keywords: DHBPS, R5P, ribB, Lyase, Metal binding, Riboflavin biosynthesis
Deposited on 2010-02-10, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lqua_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: ribB, STM3195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lqub_
  • Heterogens: 5SP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lquA (A:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lquA (A:)
    sfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsgivc
    lcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgak
    psdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarape
    ciafagqhnmavvtiedlvayrqah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lquB (B:)
    mnqtllssfgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltir
    hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvra
    aikdgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
    tmarapeciafagqhnmavvtiedlvayrqaherkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lquB (B:)
    tpfervelaldalregrgvmvldenegdmifpaetmtveqmaltirhgsgivclcitedr
    rkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnrp
    ghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafagq
    hnmavvtiedlvayrqah