PDB entry 3lq8

View 3lq8 on RCSB PDB site
Description: Structure of the kinase domain of c-Met bound to XL880 (GSK1363089)
Class: transferase
Keywords: kinase domain, XL880, GSK1363089, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2010-02-08, released 2010-05-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lq8a_
  • Heterogens: 88Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lq8A (A:)
    gsvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglard
    mydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lq8A (A:)
    idlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksl
    nrigevsqfltegiimkdfshpnvlsllgiclsplvvlpymkhgdlrnfirnethnptvk
    dligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglarddkeyysaklpv
    kwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpey
    cpdplyevmlkcwhpkaemrpsfselvsrisaifstfi