PDB entry 3lq5

View 3lq5 on RCSB PDB site
Description: Structure of CDK9/CyclinT in complex with S-CR8
Class: transcription/inhibitor
Keywords: TRANSCRIPTIONAL CDK-CYCLIN COMPLEX, PHOSPHORYLATED, ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, NUCLEUS, PHOSPHOPROTEIN, SERINE/THREONINE-PROTEIN KINASE, TRANSCRIPTION REGULATION, TRANSFERASE, CELL CYCLE, CELL DIVISION, HOST-VIRUS INTERACTION,, TRANSCRIPTION-INHIBITOR complex
Deposited on 2010-02-08, released 2011-01-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.165
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC2L4, CDK9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lq5a_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60563 (Start-259)
      • engineered mutation (77)
      • engineered mutation (96)
      • engineered mutation (241)
    Domains in SCOPe 2.05: d3lq5b1, d3lq5b2
  • Heterogens: SLQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lq5A (A:)
    gpakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegf
    pitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlv
    kftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslakn
    sqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqla
    lisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvld
    paqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lq5A (A:)
    dsvecpfcdevskyeklakigqfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
    glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslapnrytnrvvtlwyrppel
    llgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdny
    elyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdp
    mpsdlkgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lq5B (B:)
    gpegerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqlti
    ntaivymhrfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslp
    dtrseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmat
    nslhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelth
    ellqilektpnrlkriwnwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lq5B (B:)
    nkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymhr
    fymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseaylq
    qvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttfs
    lqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthellqilekt
    pnrlkriwnwr