PDB entry 3lpy

View 3lpy on RCSB PDB site
Description: Crystal structure of the RRM domain of CyP33
Class: isomerase
Keywords: RRM, CyP33, MLL1 binding, Isomerase, mRNA processing, mRNA splicing, Nucleus, RNA-binding, Rotamase, Spliceosome
Deposited on 2010-02-07, released 2010-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNP9 (1-78)
      • expression tag (0)
    Domains in SCOPe 2.01: d3lpya_
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNP9 (1-78)
      • expression tag (0)
    Domains in SCOPe 2.01: d3lpyb_
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpyA (A:)
    skrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaa
    idnmneselfgrtirvnla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpyB (B:)
    skrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaa
    idnmneselfgrtirvnla