PDB entry 3lpw

View 3lpw on RCSB PDB site
Description: Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin
Class: structural protein
Keywords: intracellular FnIII-tandem, STRUCTURAL PROTEIN
Deposited on 2010-02-06, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.179
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A77-A78 domain from Titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (3-196)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3lpwa1, d3lpwa2, d3lpwa3
  • Chain 'B':
    Compound: A77-A78 domain from Titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (3-196)
      • expression tag (2)
    Domains in SCOPe 2.07: d3lpwb1, d3lpwb2, d3lpwb3
  • Heterogens: MPD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpwA (A:)
    gamdtpgppqdlkvkevtktsvtltwdpplldggskiknyivekrestrkaystvatnch
    ktswkvdqlqegcsyyfrvlaeneygiglpaetaesvkaserplppgkitlmdvtrnsvs
    lswekpehdggsrilgyivemqtkgsdkwatcatvkvteatitgliqgeeysfrvsaqne
    kgisdprqlsvpviakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lpwB (B:)
    gamdtpgppqdlkvkevtktsvtltwdpplldggskiknyivekrestrkaystvatnch
    ktswkvdqlqegcsyyfrvlaeneygiglpaetaesvkaserplppgkitlmdvtrnsvs
    lswekpehdggsrilgyivemqtkgsdkwatcatvkvteatitgliqgeeysfrvsaqne
    kgisdprqlsvpviakd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lpwB (B:)
    mdtpgppqdlkvkevtktsvtltwdpplldggskiknyivekrestrkaystvatnchkt
    swkvdqlqegcsyyfrvlaeneygiglpaetaesvkaserplppgkitlmdvtrnsvsls
    wekpehdggsrilgyivemqtkgsdkwatcatvkvteatitgliqgeeysfrvsaqnekg
    isdprqlsvpviakd