PDB entry 3lpp

View 3lpp on RCSB PDB site
Description: Crystal complex of N-terminal sucrase-isomaltase with kotalanol
Class: hydrolase
Keywords: Glycoside hydrolase family 31, isomaltase, alpha-glucosidase, Cell membrane, Disease mutation, Disulfide bond, Glycoprotein, Glycosidase, Hydrolase, Membrane, Multifunctional enzyme, Polymorphism, Signal-anchor, Sulfation, Transmembrane
Deposited on 2010-02-05, released 2010-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.179
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrase-isomaltase
    Species: Homo sapiens [TaxId:9606]
    Gene: SI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14410 (28-897)
      • expression tag (27)
    Domains in SCOPe 2.06: d3lppa1, d3lppa2, d3lppa3, d3lppa4, d3lppa5
  • Chain 'B':
    Compound: Sucrase-isomaltase
    Species: Homo sapiens [TaxId:9606]
    Gene: SI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lppb1, d3lppb2, d3lppb3, d3lppb4
  • Chain 'C':
    Compound: Sucrase-isomaltase
    Species: Homo sapiens [TaxId:9606]
    Gene: SI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14410 (28-897)
      • expression tag (27)
    Domains in SCOPe 2.06: d3lppc1, d3lppc2, d3lppc3, d3lppc4, d3lppc5
  • Chain 'D':
    Compound: Sucrase-isomaltase
    Species: Homo sapiens [TaxId:9606]
    Gene: SI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lppd1, d3lppd2, d3lppd3, d3lppd4
  • Heterogens: NAG, TRS, PEG, CL, BMA, KTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lppA (A:)
    rsshhhhhhgefdipttenlyfqsgirrkcpnvlndpvnvrincipeqfptegicaqrgc
    cwrpwndslipwcffvdnhgynvqdmtttsigveaklnripsptlfgndinsvlfttqnq
    tpnrfrfkitdpnnrryevphqyvkeftgptvsdtlydvkvaqnpfsiqvirksngktlf
    dtsigplvysdqylqisarlpsdyiygigeqvhkrfrhdlswktwpiftrdqlpgdnnnn
    lyghqtffmciedtsgksfgvflmnsnameifiqptpivtyrvtggildfyillgdtpeq
    vvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdidyme
    dkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntqhvw
    inesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevssfi
    qgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiateqa
    vqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplvgad
    icgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqyltiry
    tllpflytlfykahvfgetvarpvlhefyedtnswiedteflwgpallitpvlkqgadtv
    sayipdaiwydyesgakrpwrkqrvdmylpadkiglhlrggyiipiqepdvtttasrknp
    lglivalgenntakgdffwddgetkdtiqngnyilytfsvsnntldivcthssyqegttl
    afqtvkilgltdsvtevrvaennqpmnahsnftydasnqvlliadlklnlgrnfsvqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lppA (A:)
    rkcpnvlndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmt
    ttsigveaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkef
    tgptvsdtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiyg
    igeqvhkrfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsn
    ameifiqptpivtyrvtggildfyillgdtpeqvvqqyqqlvglpampaywnlgfqlsrw
    nyksldvvkevvrrnreagipfdtqvtdidymedkkdftydqvafnglpqfvqdlhdhgq
    kyviildpaisigrrangttyatyergntqhvwinesdgstpiigevwpgltvypdftnp
    ncidwwanecsifhqevqydglwidmnevssfiqgstkgcnvnklnyppftpdildklmy
    skticmdavqnwgkqydvhslygysmaiateqavqkvfpnkrsfiltrstfagsgrhaah
    wlgdntasweqmewsitgmlefslfgiplvgadicgfvaetteelcrrwmqlgafypfsr
    nhnsdgyehqdpaffgqnsllvkssrqyltirytllpflytlfykahvfgetvarpvlhe
    fyedtnswiedteflwgpallitpvlkqgadtvsayipdaiwydyesgakrpwrkqrvdm
    ylpadkiglhlrggyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdt
    iqngnyilytfsvsnntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmn
    ahsnftydasnqvlliadlklnlgrnfsvqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lppB (B:)
    rsshhhhhhgefdipttenlyfqsgirrkcpnvlndpvnvrincipeqfptegicaqrgc
    cwrpwndslipwcffvdnhgynvqdmtttsigveaklnripsptlfgndinsvlfttqnq
    tpnrfrfkitdpnnrryevphqyvkeftgptvsdtlydvkvaqnpfsiqvirksngktlf
    dtsigplvysdqylqisarlpsdyiygigeqvhkrfrhdlswktwpiftrdqlpgdnnnn
    lyghqtffmciedtsgksfgvflmnsnameifiqptpivtyrvtggildfyillgdtpeq
    vvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdidyme
    dkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntqhvw
    inesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevssfi
    qgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiateqa
    vqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplvgad
    icgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqyltiry
    tllpflytlfykahvfgetvarpvlhefyedtnswiedteflwgpallitpvlkqgadtv
    sayipdaiwydyesgakrpwrkqrvdmylpadkiglhlrggyiipiqepdvtttasrknp
    lglivalgenntakgdffwddgetkdtiqngnyilytfsvsnntldivcthssyqegttl
    afqtvkilgltdsvtevrvaennqpmnahsnftydasnqvlliadlklnlgrnfsvqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lppB (B:)
    cpnvlndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmttt
    sigveaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkeftg
    ptvsdtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiygig
    eqvhkrfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsnam
    eifiqptpivtyrvtggildfyillgdtpeqvvqqyqqlvglpampaywnlgfqlsrwny
    ksldvvkevvrrnreagipfdtqvtdidymedkkdftydqvafnglpqfvqdlhdhgqky
    viildpaisigrrangttyatyergntqhvwinesdgstpiigevwpgltvypdftnpnc
    idwwanecsifhqevqydglwidmnevssfiqgstkgcnvnklnyppftpdildklmysk
    ticmdavqnwgkqydvhslygysmaiateqavqkvfpnkrsfiltrstfagsgrhaahwl
    gdntasweqmewsitgmlefslfgiplvgadicgfvaetteelcrrwmqlgafypfsrnh
    nsdgyehqdpaffgqnsllvkssrqyltirytllpflytlfykahvfgetvarpvlhefy
    edtnswiedteflwgpallitpvlkqgadtvsayipdaiwydyesgakrpwrkqrvdmyl
    padkiglhlrggyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdtiq
    ngnyilytfsvsnntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmnah
    snftydasnqvlliadlklnlgrnfsvqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lppC (C:)
    rsshhhhhhgefdipttenlyfqsgirrkcpnvlndpvnvrincipeqfptegicaqrgc
    cwrpwndslipwcffvdnhgynvqdmtttsigveaklnripsptlfgndinsvlfttqnq
    tpnrfrfkitdpnnrryevphqyvkeftgptvsdtlydvkvaqnpfsiqvirksngktlf
    dtsigplvysdqylqisarlpsdyiygigeqvhkrfrhdlswktwpiftrdqlpgdnnnn
    lyghqtffmciedtsgksfgvflmnsnameifiqptpivtyrvtggildfyillgdtpeq
    vvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdidyme
    dkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntqhvw
    inesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevssfi
    qgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiateqa
    vqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplvgad
    icgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqyltiry
    tllpflytlfykahvfgetvarpvlhefyedtnswiedteflwgpallitpvlkqgadtv
    sayipdaiwydyesgakrpwrkqrvdmylpadkiglhlrggyiipiqepdvtttasrknp
    lglivalgenntakgdffwddgetkdtiqngnyilytfsvsnntldivcthssyqegttl
    afqtvkilgltdsvtevrvaennqpmnahsnftydasnqvlliadlklnlgrnfsvqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lppC (C:)
    rkcpnvlndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmt
    ttsigveaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkef
    tgptvsdtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiyg
    igeqvhkrfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsn
    ameifiqptpivtyrvtggildfyillgdtpeqvvqqyqqlvglpampaywnlgfqlsrw
    nyksldvvkevvrrnreagipfdtqvtdidymedkkdftydqvafnglpqfvqdlhdhgq
    kyviildpaisigrrangttyatyergntqhvwinesdgstpiigevwpgltvypdftnp
    ncidwwanecsifhqevqydglwidmnevssfiqgstkgcnvnklnyppftpdildklmy
    skticmdavqnwgkqydvhslygysmaiateqavqkvfpnkrsfiltrstfagsgrhaah
    wlgdntasweqmewsitgmlefslfgiplvgadicgfvaetteelcrrwmqlgafypfsr
    nhnsdgyehqdpaffgqnsllvkssrqyltirytllpflytlfykahvfgetvarpvlhe
    fyedtnswiedteflwgpallitpvlkqgadtvsayipdaiwydyesgakrpwrkqrvdm
    ylpadkiglhlrggyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdt
    iqngnyilytfsvsnntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmn
    ahsnftydasnqvlliadlklnlgrnfsvqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lppD (D:)
    rsshhhhhhgefdipttenlyfqsgirrkcpnvlndpvnvrincipeqfptegicaqrgc
    cwrpwndslipwcffvdnhgynvqdmtttsigveaklnripsptlfgndinsvlfttqnq
    tpnrfrfkitdpnnrryevphqyvkeftgptvsdtlydvkvaqnpfsiqvirksngktlf
    dtsigplvysdqylqisarlpsdyiygigeqvhkrfrhdlswktwpiftrdqlpgdnnnn
    lyghqtffmciedtsgksfgvflmnsnameifiqptpivtyrvtggildfyillgdtpeq
    vvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdidyme
    dkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntqhvw
    inesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevssfi
    qgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiateqa
    vqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplvgad
    icgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqyltiry
    tllpflytlfykahvfgetvarpvlhefyedtnswiedteflwgpallitpvlkqgadtv
    sayipdaiwydyesgakrpwrkqrvdmylpadkiglhlrggyiipiqepdvtttasrknp
    lglivalgenntakgdffwddgetkdtiqngnyilytfsvsnntldivcthssyqegttl
    afqtvkilgltdsvtevrvaennqpmnahsnftydasnqvlliadlklnlgrnfsvqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lppD (D:)
    lndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmtttsigv
    eaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkeftgptvs
    dtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiygigeqvh
    krfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsnameifi
    qptpivtyrvtggildfyillgdtpeqvvqqyqqlvglpampaywnlgfqlsrwnyksld
    vvkevvrrnreagipfdtqvtdidymedkkdftydqvafnglpqfvqdlhdhgqkyviil
    dpaisigrryatyergntqhvwinesdgstpiigevwpgltvypdftnpncidwwanecs
    ifhqevqydglwidmnevssfiqgstkgcnvnklnyppftpdildklmyskticmdavqn
    wgkqydvhslygysmaiateqavqkvfpnkrsfiltrstfagsgrhaahwlgdntasweq
    mewsitgmlefslfgiplvgadicgfvaetteelcrrwmqlgafypfsrnhnsdgyehqd
    paffgqnsllvkssrqyltirytllpflytlfykahvfgetvarpvlhefyedtnswied
    teflwgpallitpvlkqgadtvsayipdaiwydyesgakrpwrkqrvdmylpadkiglhl
    rggyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdtiqngnyilytf
    svsnntldivcthssyqegttlafqtvkilgltdsvtevrvaehsnftydasnqvlliad
    lklnlgrnfsvqw