PDB entry 3lpe

View 3lpe on RCSB PDB site
Description: Crystal structure of Spt4/5NGN heterodimer complex from Methanococcus jannaschii
Class: transferase
Keywords: Transcription Regulation, Spt4, Spt5, NusG, Archaea, evolution, DNA-directed RNA polymerase, Metal-binding, Nucleotidyltransferase, Transcription, Transferase, Zinc-finger
Deposited on 2010-02-05, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcription antitermination protein nusG
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57818 (10-91)
      • expression tag (8-9)
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit E''
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpoE2, MJ0396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lpeb_
  • Chain 'C':
    Compound: Putative transcription antitermination protein nusG
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57818 (10-91)
      • expression tag (8-9)
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit E''
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpoE2, MJ0396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lped_
  • Chain 'E':
    Compound: Putative transcription antitermination protein nusG
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57818 (10-91)
      • expression tag (8-9)
  • Chain 'F':
    Compound: DNA-directed RNA polymerase subunit E''
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpoE2, MJ0396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lpef_
  • Chain 'G':
    Compound: Putative transcription antitermination protein nusG
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57818 (10-91)
      • expression tag (8-9)
  • Chain 'H':
    Compound: DNA-directed RNA polymerase subunit E''
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: rpoE2, MJ0396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lpeh_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpeB (B:)
    mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpeD (D:)
    mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpeF (F:)
    mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lpeH (H:)
    mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke