PDB entry 3lo3

View 3lo3 on RCSB PDB site
Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
Class: structure genomics, unknown function
Keywords: structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, structure genomics, unknown function, structure genomics, unknown function
Deposited on 2010-02-03, released 2010-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3a_
  • Chain 'B':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3b_
  • Chain 'C':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3c_
  • Chain 'D':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3d_
  • Chain 'E':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3e_
  • Chain 'F':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3f_
  • Chain 'G':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3g_
  • Chain 'H':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3h_
  • Chain 'I':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3i_
  • Chain 'J':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3j_
  • Chain 'K':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3k_
  • Chain 'L':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3l_
  • Chain 'M':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3m_
  • Chain 'N':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3n_
  • Chain 'O':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3o_
  • Chain 'P':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3p_
  • Chain 'Q':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3q_
  • Chain 'R':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3r_
  • Chain 'S':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3s_
  • Chain 'T':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3t_
  • Chain 'U':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3u_
  • Chain 'V':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3v_
  • Chain 'W':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3w_
  • Chain 'X':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3x_
  • Chain 'Y':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3y_
  • Chain 'Z':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3lo3z_
  • Chain 'a':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
  • Chain 'b':
    Compound: uncharacterized conserved protein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q484V4 (3-93)
      • expression tag (0-2)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3A (A:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3B (B:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3C (C:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3D (D:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3E (E:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3F (F:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3G (G:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3H (H:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3I (I:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3J (J:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3K (K:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3L (L:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3M (M:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3N (N:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3O (O:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3P (P:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3Q (Q:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3R (R:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3S (S:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3T (T:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3U (U:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3V (V:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3W (W:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3X (X:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3Y (Y:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lo3Z (Z:)
    snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
    psredaynwyhseeyqalistrdlgmdsqfqlig
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.