PDB entry 3lny

View 3lny on RCSB PDB site
Description: Second PDZ domain from human PTP1E in complex with RA-GEF2 peptide
Class: signaling protein/signaling protein
Keywords: PDZ2, Structural Genomics, Protein Structure Initiative, PSI-2, Center for Eukaryotic Structural Genomics, CESG, Cytoskeleton, Cell membrane, Guanine-nucleotide releasing factor, signaling protein-signaling protein complex
Deposited on 2010-02-03, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 13
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN13, PNP1, PTP1E, PTPL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lnya_
  • Chain 'B':
    Compound: Rap guanine nucleotide exchange factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: RAPGEF6, PDZGEF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SCN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lnyA (A:)
    pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
    vngvslegathkqavetlrntgqvvhlllekgqspt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnyA (A:)
    pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
    vngvslegathkqavetlrntgqvvhlllekgqs
    

  • Chain 'B':
    No sequence available.