PDB entry 3lny

View 3lny on RCSB PDB site
Description: Second PDZ domain from human PTP1E in complex with RA-GEF2 peptide
Class: signaling protein/signaling protein
Keywords: PDZ2, Structural Genomics, Protein Structure Initiative, PSI-2, Center for Eukaryotic Structural Genomics, CESG, Cytoplasm, Cytoskeleton, Cell membrane, Guanine-nucleotide releasing factor, signaling protein-signaling protein complex
Deposited on 2010-02-03, released 2010-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.164
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein phosphatase non-receptor type 13
  Species: Homo sapiens [TaxId:9606]
  Gene: PTPN13, PNP1, PTP1E, PTPL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12923 (0-End)
  Domains in SCOPe 2.03: d3lnya_
• Chain 'B':
  Compound: Rap guanine nucleotide exchange factor 6
  Species: Homo sapiens [TaxId:9606]
  Gene: RAPGEF6, PDZGEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TEU7 (0-5)
• Heterogens: SCN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3lnyA (A:)
  pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
  vngvslegathkqavetlrntgqvvhlllekgqspt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3lnyA (A:)
  pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
  vngvslegathkqavetlrntgqvvhlllekgqs
  

  
  
• Chain 'B':
  No sequence available.