PDB entry 3lno

View 3lno on RCSB PDB site
Description: Crystal Structure of Domain of Unknown Function DUF59 from Bacillus anthracis
Class: unknown function
Keywords: alpha-beta fold, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, UNKNOWN FUNCTION
Deposited on 2010-02-02, released 2010-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3lnoa_
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-107)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3lnob_
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d3lnoc_
  • Chain 'D':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d3lnod_
  • Chain 'E':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d3lnoe_
  • Chain 'F':
    Compound: Putative uncharacterized protein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4906, BA_5281, GBAA5281, GBAA_5281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81XF6 (3-107)
      • expression tag (2)
    Domains in SCOPe 2.05: d3lnof_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lnoA (A:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoA (A:)
    namsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmag
    qivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lnoB (B:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoB (B:)
    namsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmag
    qivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lnoC (C:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoC (C:)
    namsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmag
    qivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lnoD (D:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoD (D:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lnoE (E:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoE (E:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lnoF (F:)
    snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
    gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnoF (F:)
    amsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmagq
    ivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird