PDB entry 3lnk

View 3lnk on RCSB PDB site
Description: Structure of BACE bound to SCH743813
Class: hydrolase
Keywords: Alzheimer's, BACE1, Alternative splicing, Aspartyl protease, Disulfide bond, Endoplasmic reticulum, Endosome, Glycoprotein, Golgi apparatus, Hydrolase, Membrane, Polymorphism, Protease, Transmembrane, Zymogen
Deposited on 2010-02-02, released 2010-04-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE, BACE1, KIAA1149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lnka_
  • Chain 'B':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE, BACE1, KIAA1149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3lnkb_
  • Heterogens: 74A, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lnkA (A:)
    epgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnkA (A:)
    rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
    lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
    egilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmi
    iggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlr
    lpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqs
    fritilpqqylrpvedsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
    chvhdefrtaavegpfvtldmedcgyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lnkB (B:)
    epgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhry
    yqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffin
    gsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvg
    gsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgt
    tnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgev
    tnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkr
    igfavsachvhdefrtaavegpfvtldmedcgyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lnkB (B:)
    rgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrq
    lsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnw
    egilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmi
    iggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlr
    lpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqs
    fritilpqqylrpvedsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
    chvhdefrtaavegpfvtldmedcgyn