PDB entry 3lne

View 3lne on RCSB PDB site
Description: Crystal structure of E-cadherin EC12 K14E
Class: cell adhesion
Keywords: cadherin, Calcium, Cell adhesion, Cell junction, Cell membrane, Glycoprotein, Transmembrane
Deposited on 2010-02-02, released 2010-03-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09803 (0-212)
      • engineered (13)
    Domains in SCOPe 2.05: d3lnea1, d3lnea2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lneA (A:)
    dwvippiscpeneegefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
    kvtqpldreaiakyilyshavssngeavedpmeivitvtdqndnrpeftqevfegsvaeg
    avpgtsvmkvsatdadddvntynaaiaytivsqdpelphknmftvnrdtgvisvltsgld
    resyptytlvvqaadlqgeglsttakavitvkd