PDB entry 3ln3

View 3ln3 on RCSB PDB site
Description: Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
Class: oxidoreductase
Keywords: Putative reductase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, OXIDOREDUCTASE
Deposited on 2010-02-01, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodiol dehydrogenase
    Species: Mus musculus [TaxId:10090]
    Gene: Akr1c13, ddh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ln3a_
  • Heterogens: SO4, NAD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ln3A (A:)
    gmsskqhcvklndghlipalgfgtykpkevpksksleaaclaldvgyrhvdtayayqvee
    eigqaiqskikagvvkredlfvttklwctcfrpelvkpalekslkklqldyvdlyimhyp
    vpmksgdndfpvneqgkslldtvdfcdtwerleeckdaglvksigvsnfnhrqlerilnk
    pglkykpvcnqvechlylnqrklldyceskdivlvaygalgtqrykewvdqnspvllndp
    vlcdvakknkrspalialryliqrgivplaqsfkenemrenlqvfgfqlspedmktldgl
    nknfrylpaeflvdhpeypfveey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ln3A (A:)
    qhcvklndghlipalgfgtykpkevpksksleaaclaldvgyrhvdtayayqveeeigqa
    iqskikagvvkredlfvttklwctcfrpelvkpalekslkklqldyvdlyimhypvpmks
    gdndfpvneqgkslldtvdfcdtwerleeckdaglvksigvsnfnhrqlerilnkpglky
    kpvcnqvechlylnqrklldyceskdivlvaygalgtqrykewvdqnspvllndpvlcdv
    akknkrspalialryliqrgivplaqsfkenemrenlqvfgfqlspedmktldglnknfr
    ylpaeflvdhpeypfveey