PDB entry 3lmt

View 3lmt on RCSB PDB site
Description: Crystal strucutre of DTD from Plasmodium falciparum
Class: hydrolase
Keywords: dtd, deacylase, hydrolase, iodide
Deposited on 2010-02-01, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmta_
  • Chain 'B':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmtb_
  • Chain 'C':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmtc_
  • Chain 'D':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmtd_
  • Chain 'E':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmte_
  • Chain 'F':
    Compound: D-tyrosyl-tRNA(Tyr) deacylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: DTD, PF11_0095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lmtf_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lmtA (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtA (A:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lmtB (B:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtB (B:)
    mrvviqrvkgailsvreleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lmtC (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtC (C:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lmtD (D:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtD (D:)
    mrvviqrvkgailsvrkleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
    ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
    dkikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lmtE (E:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtE (E:)
    mrvviqrvkgailsvrleiiseiknglicflgihkndtwedalyiirkclnlrlwnndnk
    twdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqyndd
    kikigkfgnymnidvtndgpvtiyidthdi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3lmtF (F:)
    mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
    nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
    defkkqynddkikigkfgnymnidvtndgpvtiyidthdinlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmtF (F:)
    mrvviqrvkgailsvrkkeleiiseiknglicflgihkndtwedalyiirkclnlrlwnn
    dnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqy
    nddkikigkfgnymnidvtndgpvtiyidthd