PDB entry 3lms

View 3lms on RCSB PDB site
Description: Structure of human activated thrombin-activatable fibrinolysis inhibitor, TAFIa, in complex with tick-derived funnelin inhibitor, TCI.
Class: hydrolase/hydrolase inhibitor
Keywords: fibrinolysis, cogaulation, funnelin, alpha-beta-hydrolase, metallopeptidase, Alternative splicing, Carboxypeptidase, Disulfide bond, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen, Blood coagulation, Metalloenzyme inhibitor, Metalloprotease inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-02-01, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Carboxypeptidase B2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96IY4 (0-308)
  Domains in SCOPe 2.08: d3lmsa_
• Chain 'B':
  Compound: carboxypeptidase inhibitor
  Species: Rhipicephalus bursa [TaxId:67831]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5EPH2 (0-73)
  Domains in SCOPe 2.08: d3lmsb1, d3lmsb2
• Heterogens: ZN, GLY, GOL, CL, CA, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lmsA (A:)
  asasyyeqyhslneiyswiefiterhpdmltkihigssfekyplyvlkvsgkeqaaknai
  widcgiharewispafclwfighitqfygiigqytnllrlvdfyvmpvvnvdgydyswkk
  nrmwrknrsfyannhcigtdlnrnfaskhwceegasssscsetycglypesepevkavas
  flrrninqikayismhsysqhivfpysytrskskdheelslvaseavraiektskntryt
  hghgsetlylapgggddwiydlgikysftielrdtgtygfllperyikptcreafaavsk
  iawhvirnv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lmsB (B:)
  necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
  sascgkgqkccvwl