PDB entry 3lmp

View 3lmp on RCSB PDB site
Description: Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative modulator
Class: transcription
Keywords: three-layered alpha-helical sandwich, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2010-01-31, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lmpa_
  • Chain 'C':
    Compound: Peptide of Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CEK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lmpA (A:)
    mrgshhhhhhgpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmns
    lmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndq
    vtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkf
    nalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfak
    llqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmpA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfeq
    skevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktetdmslhpllqeiykdly
    

  • Chain 'C':
    No sequence available.