PDB entry 3lmj

View 3lmj on RCSB PDB site
Description: Structure of human anti HIV 21c Fab
Class: immune system
Keywords: Immunoglobulin, IMMUNE SYSTEM
Deposited on 2010-01-30, released 2010-04-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of anti HIV Fab from human 21c antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LMJ (0-End)
  • Chain 'L':
    Compound: Light chain of anti HIV Fab from human 21c antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LMJ (0-214)
    Domains in SCOPe 2.04: d3lmjl1, d3lmjl2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lmjL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnigknyvswyqqlpgaapkllifddtqrpsgip
    drfsgsksgtsatlaitglqtgdeadyycgtwdsslstgqlfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektmahaecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lmjL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnigknyvswyqqlpgaapkllifddtqrpsgip
    drfsgsksgtsatlaitglqtgdeadyycgtwdsslstgqlfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektmahae