PDB entry 3llx

View 3llx on RCSB PDB site
Description: Crystal structure of an ala racemase-like protein (il1761) from idiomarina loihiensis at 1.50 A resolution
Class: isomerase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, isomerase
Deposited on 2010-01-29, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted amino acid aldolase or racemase
    Species: Idiomarina loihiensis [TaxId:283942]
    Gene: IL1761
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3llxa1, d3llxa2
  • Heterogens: ZN, CL, TRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3llxA (A:)
    gmksapdwiahpdtpyllideaklksninylkqrveslgshlrphlktlrtleaagylld
    sksapatvstlaeaeayakagytdllyavgiapaklkrvaalrqqginlhilldnitqaq
    avvdyaaefgqdfsvfieidsddhrggikpsdsklltiaktlgehftglmthaggsyacn
    teqglknfakqecdavriarnnletagihcaitsvgstptahfgedfsdisevragvytt
    fdlvmknigvcdfshiamsvvttvighnkeknwlltdsgwmalsrdsgtagqnrdfgygq
    vckidgsvldglcvnstsqehgvielsdayqledfpvghqlrimpnhacataamhpvyhv
    lmsdgshntwqritgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3llxA (A:)
    sapdwiahpdtpyllideaklksninylkqrveslgshlrphlktlrtleaagylldsks
    apatvstlaeaeayakagytdllyavgiapaklkrvaalrqqginlhilldnitqaqavv
    dyaaefgqdfsvfieidsddhrggikpsdsklltiaktlgehftglmthaggsyacnteq
    glknfakqecdavriarnnletagihcaitsvgstptahfgedfsdisevragvyttfdl
    vmknigvcdfshiamsvvttvighnkeknwlltdsgwmalsrdsgtagqnrdfgygqvck
    idgsvldglcvnstsqehgvielsdayqledfpvghqlrimpnhacataamhpvyhvlms
    dgshntwqritgw