PDB entry 3lle

View 3lle on RCSB PDB site
Description: X-ray structure of bovine SC0322,Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2010-01-28, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3llea_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lleb_
  • Heterogens: CA, SGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lleA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lleA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lleB (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lleB (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe