PDB entry 3lld

View 3lld on RCSB PDB site
Description: Crystal structure of the mutant S127G of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase, S127G, 6-azauridine 5'-monophosphate, Decarboxylase, Lyase, Pyrimidine biosynthesis
Deposited on 2010-01-28, released 2010-06-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.184
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
      • engineered mutation (126)
    Domains in SCOPe 2.02: d3llda_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
      • engineered mutation (126)
    Domains in SCOPe 2.02: d3lldb_
  • Heterogens: UP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lldA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemghpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lldA (A:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemg
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lldB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemghpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lldB (B:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemgh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdl