PDB entry 3llb

View 3llb on RCSB PDB site
Description: The crystal structure of the protein PA3983 with unknown function from Pseudomonas aeruginosa PAO1
Class: Structural Genomics, Unknown function
Keywords: protein PA3983, unknown function, structural genomics, PSI2, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2010-01-28, released 2010-03-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: GI:15599178, PA3983
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3llba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3llbA (A:)
    syikplpsgdfivkaltpvdafndffgsefsdeefdtvgglvmsafghlpkrnevvelge
    frfrvlnadsrrvhllrlsplqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3llbA (A:)
    syikplpsgdfivkaltpvdafndffgsefsdeefdtvgglvmsafghlpkrnevvelge
    frfrvlnadsrrvhllrlspl