PDB entry 3lkj

View 3lkj on RCSB PDB site
Description: Small Molecule Inhibition of the TNF Family Cyokine CD40 Ligand Through a Subunit Fracture Mechanism
Class: cytokine
Keywords: CD40L, CD154, TNF-family cytokine, protein-protein interaction, Cell membrane, Cytokine, Disease mutation, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Secreted, Signal-anchor, Transmembrane
Deposited on 2010-01-27, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd40 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40L, CD40LG, TNFSF5, TRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lkja_
  • Chain 'B':
    Compound: cd40 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40L, CD40LG, TNFSF5, TRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lkjb_
  • Chain 'C':
    Compound: cd40 ligand
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40L, CD40LG, TNFSF5, TRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lkjc_
  • Heterogens: NAG, LKJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lkjA (A:)
    qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
    reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
    vtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lkjA (A:)
    qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcas
    sqapfiaslclkspgrferillraantkpcgqqsihlggvfelqpgasvfvnvtdpsqvs
    hgtgftsfgllkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lkjB (B:)
    qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
    reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
    vtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lkjB (B:)
    qiaahviseastsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsnapf
    iaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvnvtdpsqvsh
    gtgftsfgllkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lkjC (C:)
    qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
    reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
    vtdpsqvshgtgftsfgllkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lkjC (C:)
    qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
    pfiaslclkspgrferillraantpcgqqsihlggvfelqpgasvfvnvtdpsqvshgtg
    ftsfgllkl