PDB entry 3lk0

View 3lk0 on RCSB PDB site
Description: X-ray structure of bovine SC0067,Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, METAL BINDING PROTEIN
Deposited on 2010-01-26, released 2010-12-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.238
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lk0a_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lk0b_
  • Chain 'C':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lk0c_
  • Chain 'D':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3lk0d_
  • Heterogens: CA, Z80, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lk0A (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lk0A (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lk0B (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lk0B (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lk0C (C:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lk0C (C:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheff
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lk0D (D:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe