PDB entry 3ljw

View 3ljw on RCSB PDB site
Description: Crystal Structure of the Second Bromodomain of Human Polybromo
Class: transcription
Keywords: ALPHA Helix, Alternative splicing, Bromodomain, Chromatin regulator, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on 2010-01-26, released 2010-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.173
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PB1, PBRM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ljwa_
  • Chain 'B':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PB1, PBRM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ljwb_
  • Heterogens: ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ljwA (A:)
tegsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlkti
aqriqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema

    Sequence, based on observed residues (ATOM records): (download) 
    >3ljwA (A:)
gsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlktiaq
riqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ljwB (B:)
tegsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlkti
aqriqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema