PDB entry 3ljo

View 3ljo on RCSB PDB site
Description: Bovine trypsin in complex with UB-THR 11
Class: hydrolase/hydrolase inhibitor
Keywords: Metal-binding, Serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-01-26, released 2010-10-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ljoa_
  • Heterogens: 11U, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ljoA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn