PDB entry 3ljj

View 3ljj on RCSB PDB site
Description: Bovine trypsin in complex with UB-THR 10
Class: hydrolase/hydrolase inhibitor
Keywords: Metal-binding, Serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-01-26, released 2010-10-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.259
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ljja_
  • Heterogens: 10U, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ljjA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn