PDB entry 3lja

View 3lja on RCSB PDB site
Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome
Class: structural protein/DNA
Keywords: Nucleosome, Divalent metal, Cation binding, Counterion, Compaction, Acetylation, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, STRUCTURAL PROTEIN-DNA complex
Deposited on 2010-01-26, released 2010-04-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H3.2
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84233 (Start-134)
    • see remark 999 (101)
  Domains in SCOPe 2.01: d3ljaa_
• Chain 'B':
  Compound: histone h4
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62799 (Start-101)
• Chain 'C':
  Compound: histone h2a
  Species: Xenopus laevis [TaxId:8355]
  Gene: LOC494591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6AZJ8
• Chain 'D':
  Compound: Histone H2B 1.1
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02281 (Start-121)
    • see remark 999 (28)
• Chain 'E':
  Compound: Histone H3.2
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84233 (Start-134)
    • see remark 999 (101)
  Domains in SCOPe 2.01: d3ljae_
• Chain 'F':
  Compound: histone h4
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62799 (Start-101)
• Chain 'G':
  Compound: histone h2a
  Species: Xenopus laevis [TaxId:8355]
  Gene: LOC494591
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6AZJ8
• Chain 'H':
  Compound: Histone H2B 1.1
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02281 (Start-121)
    • see remark 999 (28)
• Chain 'I':
  Compound: 147mer DNA
  Species: synthetic, synthetic
  
• Chain 'J':
  Compound: 147mer DNA
  Species: synthetic, synthetic
  
• Heterogens: MN, SO4

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ljaA (A:)
  artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
  lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
  pkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ljaA (A:)
  kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
  eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >3ljaE (E:)
  artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
  lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
  pkdiqlarrirgera
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ljaE (E:)
  kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
  eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.