PDB entry 3lj8

View 3lj8 on RCSB PDB site
Description: Crystal Structure of MKP-4
Class: hydrolase
Keywords: alpha/beta hydrolase, Hydrolase, Protein phosphatase
Deposited on 2010-01-26, released 2010-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lj8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lj8A (A:)
    sfpvqilpnlylgsardsanleslaklgiryilnvtpnlpnffekngdfhykqipisdhw
    sqnlsrffpeaiefidealsqncgvlvhclagvsrsvtvtvaylmqklhlslndaydlvk
    rkksnispnfnfmgqlldferslrle