PDB entry 3lj3

View 3lj3 on RCSB PDB site
Description: PI3-kinase-gamma with a pyrrolopyridine-benzofuran inhibitor
Class: Transferase
Keywords: ATP-binding, Kinase, Nucleotide-binding, Transferase
Deposited on 2010-01-25, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • expression tag (0)
      • variant (316)
    Domains in SCOPe 2.07: d3lj3a1, d3lj3a2, d3lj3a3, d3lj3a4, d3lj3a5
  • Heterogens: SO4, WYE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lj3A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lj3A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmseqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkewdcdrkfrvkirgi
    dipvldltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlq
    iycvrllyyvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilld
    naempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
    vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
    vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
    cgtamlhdftqqvqviemlqkvtldikslvssqvisqlkqklenlqnsqlpesfrvpydp
    glkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilr
    imesiwetesldlcllpygcistgdkigmieivkdattiakiqqsvgntgafkdevlnhw
    lkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghile
    rvpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpq
    ltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl