PDB entry 3lhv

View 3lhv on RCSB PDB site
Description: Crystal structure of the mutant V182A.I199A.V201A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
Class: lyase
Keywords: mutant V182A.I199A.V201A, 6-hydroxyuridine-5'-phosphate, Decarboxylase, Pyrimidine biosynthesis, LYASE
Deposited on 2010-01-23, released 2010-06-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.231
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (181)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.02: d3lhva_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (181)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.02: d3lhvb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (181)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.02: d3lhvc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (100)
      • engineered (181)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.02: d3lhvd_
  • Heterogens: BMQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lhvA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaaiagrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhvA (A:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqgg
    dpgetlrfadaaiagrsiyladnpaaaaagiiesikdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lhvB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaaiagrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhvB (B:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqggd
    pgetlrfadaaiagrsiyladnpaaaaagiiesikdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lhvC (C:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaaiagrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhvC (C:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqgg
    dpgetlrfadaaiagrsiyladnpaaaaagiiesikdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lhvD (D:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaaiagrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhvD (D:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqggd
    pgetlrfadaaiagrsiyladnpaaaaagiiesikdl