PDB entry 3lhp

View 3lhp on RCSB PDB site
Description: Crystal structure of HIV epitope-scaffold 4E10_D0_1ISEA_004_N 4E10 Fv complex
Class: immune system
Keywords: epitope-scaffold, immune system
Deposited on 2010-01-22, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
    Domains in SCOPe 2.07: d3lhph1, d3lhph2
  • Chain 'I':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
    Domains in SCOPe 2.07: d3lhpi_
  • Chain 'L':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
    Domains in SCOPe 2.07: d3lhpl_
  • Chain 'M':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
    Domains in SCOPe 2.07: d3lhpm_
  • Chain 'S':
    Compound: 4e10_d0_1isea_004_n (t93)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
  • Chain 'T':
    Compound: 4e10_d0_1isea_004_n (t93)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LHP
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lhpH (H:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhpH (H:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttglgkpigafahwgqgtlvt
    vssl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3lhpI (I:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhpI (I:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttglgkpigafahwgqgtlvt
    vs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lhpL (L:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhpL (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3lhpM (M:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhpM (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklv
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.