PDB entry 3lhm

View 3lhm on RCSB PDB site
Description: crystal structures of the apo-and holomutant human lysozymes with an introduced ca2+ binding site
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-10-02, released 1992-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 1994-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • conflict (85)
      • conflict (91)
    Domains in SCOP 1.75: d3lhma_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lhmA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv