PDB entry 3lh6

View 3lh6 on RCSB PDB site
Description: Crystal structure of mouse VPS29 complexed with Zn2+
Class: hydrolase
Keywords: phosphatase, PPP, Endosome Membrane, Metal-binding, Protein transport, Transport, HYDROLASE
Deposited on 2010-01-21, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.201
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: Mus musculus [TaxId:10090]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lh6a_
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: Mus musculus [TaxId:10090]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3lh6b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lh6A (A:)
    gspefgtrdrmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylk
    tlagdvhivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdi
    lisghthkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligd
    dvkverieykks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh6A (A:)
    mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
    gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
    afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
    ks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lh6B (B:)
    gspefgtrdrmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylk
    tlagdvhivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdi
    lisghthkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligd
    dvkverieykks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh6B (B:)
    mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
    gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
    afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
    ks