PDB entry 3lh2

View 3lh2 on RCSB PDB site
Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex
Class: immune system
Keywords: epitope-scaffold, immune system
Deposited on 2010-01-21, released 2010-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2h_
  • Chain 'I':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2i_
  • Chain 'J':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2j_
  • Chain 'K':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2k_
  • Chain 'L':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2l_
  • Chain 'M':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2m_
  • Chain 'N':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2n_
  • Chain 'O':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
    Domains in SCOPe 2.04: d3lh2o_
  • Chain 'S':
    Compound: 4e10_1vi7a_s0_002_n (t88)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
  • Chain 'T':
    Compound: 4e10_1vi7a_s0_002_n (t88)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
  • Chain 'U':
    Compound: 4e10_1vi7a_s0_002_n (t88)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
  • Chain 'V':
    Compound: 4e10_1vi7a_s0_002_n (t88)
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LH2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3lh2H (H:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2H (H:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttlgkpigafahwgqgtlvtv
    sslehhh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3lh2I (I:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2I (I:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttgkpigafahwgqgtlvtvs
    slehhhh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3lh2J (J:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2J (J:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
    lvtvs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3lh2K (K:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2K (K:)
    vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
    prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
    lvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3lh2L (L:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2L (L:)
    aeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgv
    adrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3lh2M (M:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2M (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3lh2N (N:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2N (N:)
    aeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgv
    adrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3lh2O (O:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lh2O (O:)
    aeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgv
    adrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.