PDB entry 3lgr

View 3lgr on RCSB PDB site
Description: Xylanase II from Trichoderma reesei cocrystallized with tris-dipicolinate europium
Class: hydrolase
Keywords: Europium tris-dipicolinate complex, Glycoprotein, Glycosidase, Hydrolase, Xylan degradation
Deposited on 2010-01-21, released 2011-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: Hypocrea jecorina [TaxId:51453]
  Gene: xyn2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (1-189)
    • expression tag (0)
  Domains in SCOPe 2.08: d3lgra1, d3lgra2
• Heterogens: EU, PDC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lgrA (A:)
  etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
  nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
  qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
  ssgsasitvs