PDB entry 3lgm
View 3lgm on RCSB PDB site
Description: Crystal structure of reduced IsdI in complex with heme
Class: Oxidoreductase
Keywords: Dimeric alpha+beta barrel, Cytoplasm, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on
2010-01-20, released
2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated
2010-03-31, with a file datestamp of
2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Heme-degrading monooxygenase isdI
Species: Staphylococcus aureus [TaxId:158879]
Gene: isdI
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3lgma1, d3lgma2 - Chain 'B':
Compound: Heme-degrading monooxygenase isdI
Species: Staphylococcus aureus [TaxId:158879]
Gene: isdI
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3lgmb1, d3lgmb2 - Heterogens: HEM, MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3lgmA (A:)
ahmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwe
sedsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3lgmB (B:)
ahmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwe
sedsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk