PDB entry 3lgj

View 3lgj on RCSB PDB site
Description: Crystal structure of single-stranded binding protein (ssb) from Bartonella henselae
Class: DNA binding protein
Keywords: NIAID, Cat Scratch Fever, Rochalimaea, lyme disease, ALS Collaborative Crystallography, DNA replication, DNA-binding, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, DNA BINDING PROTEIN
Deposited on 2010-01-20, released 2010-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Bartonella henselae [TaxId:38323]
    Gene: ssb2, ssb3, BH07030, BH09470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6G3Q0 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.04: d3lgja_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Bartonella henselae [TaxId:38323]
    Gene: ssb2, ssb3, BH07030, BH09470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6G3Q0 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.04: d3lgjb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lgjA (A:)
    mahhhhhhmgtleaqtqgpgsmlnkvmligylgddpesktmtsgaevvnfrmatfesymn
    knthqkvektewhsvvvfnphfakialqylhkgskvyiegklqtrkwqdknghdryttei
    vlpqykgelhlldakkeqsassssvtsqsyaiasgaddygisahdsmpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lgjA (A:)
    gsmlnkvmligylgddpesktmtsgaevvnfrmatfektewhsvvvfnphfakialqylh
    kgskvyiegklqtrkwytteivlpqykgelhllda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lgjB (B:)
    mahhhhhhmgtleaqtqgpgsmlnkvmligylgddpesktmtsgaevvnfrmatfesymn
    knthqkvektewhsvvvfnphfakialqylhkgskvyiegklqtrkwqdknghdryttei
    vlpqykgelhlldakkeqsassssvtsqsyaiasgaddygisahdsmpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lgjB (B:)
    gsmlnkvmligylgddpesktmtsgaevvnfrmatfeektewhsvvvfnphfakialqyl
    hkgskvyiegklqtrkwqdytteivlpqykgelhlld