PDB entry 3lgc

View 3lgc on RCSB PDB site
Description: Crystal Structure of Glutaredoxin 1 from Francisella tularensis
Class: unknown function
Keywords: alpha-beta sandwich, Structural Genomics, structural genomics of infectious diseases, Center for Structural Genomics of Infectious Diseases, CSGID, UNKNOWN FUNCTION
Deposited on 2010-01-20, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glutaredoxin 1
  Species: Francisella tularensis subsp. tularensis [TaxId:177416]
  Gene: FTT0533c, FTT_0533c, grxA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NHD0 (3-88)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d3lgca1, d3lgca2
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lgcA (A:)
  snamkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpis
  tvpqifiddehiggftelkanadkilnkk