PDB entry 3lfu

View 3lfu on RCSB PDB site
Description: Crystal Structure of E. coli UvrD
Class: hydrolase
Keywords: DNA helicase, SF1 helicase, ATP-binding, DNA damage, DNA repair, DNA replication, DNA-binding, Helicase, Hydrolase, Nucleotide-binding, SOS response
Deposited on 2010-01-18, released 2011-02-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA helicase II
    Species: Escherichia coli [TaxId:562]
    Gene: b3813, JW3786, mutU, pdeB, rad, recL, uvrD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lfua1, d3lfua2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lfuA (A:)
    mdvsylldslndkqreavaaprsnllvlagagsgktrvlvhriawlmsvencspysimav
    tftnkaaaemrhrigqlmgtsqggmwvgtfhglahrllrahhmdanlpqdfqildsedql
    rllkrlikamnldekqwpprqamwyinsqkdeglrphhiqsygnpveqtwqkvyqayqea
    cdraglvdfaelllrahelwlnkphilqhyrerftnilvdefqdtnniqyawirllagdt
    gkvmivgdddqsiygwrgaqveniqrflndfpgaetirleqnyrstsnilsaanalienn
    ngrlgkklwtdgadgepislycafneldearfvvnriktwqdnggalaecailyrsnaqs
    rvleeallqasmpyriyggmrfferqeikdalsylrlianrnddaafervvntptrgigd
    rtldvvrqtsrdrqltlwqacrellqekalagraasalqrfmelidalaqetadmplhvq
    tdrvikdsglrtmyeqekgekgqtrienleelvtatrqfsyneededlmplqaflshaal
    eagegqadtwqdavqlmtlhsakglefpqvfivgmeegmfpsqmsldeggrleeerrlay
    vgvtramqkltltyaetrrlygkevyhrpsrfigelpeecveevrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lfuA (A:)
    vsylldslndkqreavaaprsnllvlagagsgktrvlvhriawlmsvencspysimavtf
    tnkaaaemrhrigqlmgtsqggmwvgtfhglahrllrahhmdanlpqdfqildsedqlrl
    lkrlikamnldekqwpprqamwyinsqkdeglrphhinpveqtwqkvyqayqeacdragl
    vdfaelllrahelwlnkphilqhyrerftnilvdefqdtnniqyawirllagdtgkvmiv
    gdddqsiygwrgaqveniqrflndfpgaetirleqnyrstsnilsaanaliennngrlgk
    klwtdgadgepislycafneldearfvvnriktwqdnggalaecailyrsnaqsrvleea
    llqasmpyriyggmrfferqeikdalsylrlianrnddaafervvntptrgigdrtldvv
    rqtsrdrqltlwqacrellqekalagraasalqrfmelidalaqetadmplhvqtdrvik
    dsglrtmyeqekgekgqtrienleelvtatrqfsedlmplqaflshaalegegqadtwqd
    avqlmtlhsakglefpqvfivgmeegmfpsqmslggrleeerrlayvgvtramqkltlty
    aetrrlygkevyhrpsrfigelpeecveevrlr