PDB entry 3lfl

View 3lfl on RCSB PDB site
Description: Crystal Structure of human Glutathione Transferase Omega 1, delta 155
Class: transferase
Keywords: Glutathione S-transferase omega 1 del155, protein-glutathione complex, N-terminal Thioredoxin-like domain, C-terminal alpha-helical domain, TRANSFERASE
Deposited on 2010-01-18, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase omega-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTO1, GSTTLP28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lfla1, d3lfla2
  • Chain 'B':
    Compound: Glutathione S-transferase omega-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTO1, GSTTLP28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lflb1, d3lflb2
  • Chain 'C':
    Compound: Glutathione S-transferase omega-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTO1, GSTTLP28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lflc1, d3lflc2
  • Heterogens: GSH, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lflA (A:)
    msgesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkp
    ewffkknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelf
    skvpslvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwf
    erleamklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lflA (A:)
    sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
    kknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelfskvp
    slvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwferle
    amklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdygl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lflB (B:)
    msgesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkp
    ewffkknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelf
    skvpslvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwf
    erleamklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lflB (B:)
    sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
    kknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelfskvp
    slvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwferle
    amklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lflC (C:)
    msgesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkp
    ewffkknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelf
    skvpslvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwf
    erleamklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lflC (C:)
    sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
    kknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelfskvp
    slvgsfirsqnkedyaglkeefrkeftklevltnkkttffggnsismidyliwpwferle
    amklnecvdhtpklklwmaamkedptvsalltsekdwqgflely